PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G03420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 286aa    MW: 30648.9 Da    PI: 4.8026
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G03420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B386.22.8e-2771160192
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                      f+kv tpsdv+k++rlv+pk++ae++    + +++l +ed+ g  W+++++y+++s++yv+tkGW++Fv+a +L +gD+v F++    ++++
  ONIVA08G03420.1  71 FDKVVTPSDVGKLNRLVVPKQHAERFFPAAAAGTQLCFEDRAGTPWRFRYSYWGSSQSYVMTKGWSRFVRAARLSAGDTVSFSRA--ADGRY 160
                      89************************666678889************************************************43..45544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.1E-3666159IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-2768162IPR015300DNA-binding pseudobarrel domain
CDDcd100173.97E-2369162No hitNo description
SMARTSM010191.5E-1871172IPR003340B3 DNA binding domain
PROSITE profilePS5086313.94471168IPR003340B3 DNA binding domain
PfamPF023621.3E-2471160IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MYMDLTLGGA LLQVEEATEE EEEEEEEEQA LGQEPAPAAA AAALVLGRRH GVVVGGGGGG  60
VVVAAEREHM FDKVVTPSDV GKLNRLVVPK QHAERFFPAA AAGTQLCFED RAGTPWRFRY  120
SYWGSSQSYV MTKGWSRFVR AARLSAGDTV SFSRAADGRY FIDYRHCHRH GGRDISFASA  180
ATAMPAAWPL FGRVQTAAPV SYGGGHGSAA AATMFLDTVA PVAAAGGHRG EVGPSGQRSF  240
RLFGVNVECG GDVDAAAEEE DADDDVDDGD HRRGEEMELV MWTNHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A2e-366816511115DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649372.11e-146PREDICTED: putative B3 domain-containing protein Os08g0157700
SwissprotQ7EZD51e-148Y8577_ORYSJ; Putative B3 domain-containing protein Os08g0157700
TrEMBLA0A0E0I7E90.0A0A0E0I7E9_ORYNI; Uncharacterized protein
TrEMBLA2YRE50.0A2YRE5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA028020-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141642426
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61970.13e-45B3 family protein